100026877kberry 100026877kberry

11-01-2017
Mathematics

contestada

what is 2/3 to the 0th power plz let me know asap!!!
worth 10 pts

Respuesta :

mileszsmith mileszsmith

11-01-2017

Anything to the zeroth power is 1, just remember that.
Hope this helps!

Answer Link

VillagerMCGirl VillagerMCGirl

11-01-2017

2/3 to the 0th power is 1

Answer Link

Otras preguntas

If 2x – 3 + 3x = – 28, what is the value of x? 4 -1 -5 5

What effect does the dwarves' song in Chapter 1 have on the plot of The Hobbit? It is a turning pont in the story when Bilbo realizes he has no choice but to he

which table represents a linear function?

What happens when self-determination mechanisms break down?

In a school of 200 students, 90 students are in the marching band, 145 students are on sports teams and 75 students participate in both activities. How many stu

can someone please help me with these ?? asap

What can you tell us in regards to Newton’s 3rd law what must be true in regards to what force the stump is applying to the elephant.

Factor and solve each quadratic equation. Show your work x2 + 5x + 6 = 0

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

If I initially have a gas at a pressure of 10.0 atm, a volume of 24.0 liters, and a temperature of 200. K, and then I raise the pressure to 14.0 atm and increas